AlphaFold
AlphaFold can predict protein structures with atomic accuracy even where no similar structure is known AlphaFold Homepage
Available Modules¶
module load AlphaFold/3.0.2
Prerequisite
An extended version of AlphaFold2 on Mahuika cluster which contains additional information such as visualisation of AlphaFold outputs, etc can be found here
Description¶
AlphaFold is a deep-learning system, developed by Google DeepMind, that predicts a protein's three-dimensional structure from its amino acid sequence. It combines evolutionary information from a multiple sequence alignment (MSA) of related proteins with structural templates, and returns per-residue confidence estimates (pLDDT) alongside the predicted coordinates. AlphaFold 2 achieved breakthrough accuracy in the CASP14 assessment (2020), in many cases approaching experimental quality; the later AlphaFold 3 extends prediction beyond single proteins to complexes that also contain nucleic acids, ligands and ions.
This package provides an implementation of the inference pipeline of AlphaFold.
Referencing¶
Any publication that discloses findings arising from using this source code or the model parameters should cite the AlphaFold paper. Please also refer to the Supplementary Information for a detailed description of the method.
Home page is at https://github.com/deepmind/alphafold
AlphaFold Databases¶
AlphaFold databases are stored in /opt/nesi/db/alphafold_db/ parent
directory. In order to make the database calling more convenient, we
have prepared modules for each version of the database. Running
module spider AlphaFold2DB will list the available versions based on
when they were downloaded (Year-Month)
$ module spider AlphaFold2DB
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
AlphaFold2DB: AlphaFold2DB/2022-06
--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
Description:
AlphaFold2 databases
Versions:
AlphaFold2DB/2022-06
AlphaFold2DB/2023-04
Loading a module will set the $AF2DB variable which is pointing to
the selected version of the database. For an example.
$ module load AlphaFold2DB/2023-04
$ echo $AF2DB
/opt/nesi/db/alphafold_db/2023-04
AlphaFold 3¶
AlphaFold 3 can predict the joint structure of complexes that can include proteins, nucleic acids (DNA/RNA), ligands, ions and modified residues. It takes its input as a JSON file, and the workflow is split into a CPU-bound data pipeline (genetic and template search) and a GPU-bound inference stage.
Note that AlphaFold 3 predicts the three-dimensional structure of these complexes (with per-residue and per-pair confidence estimates). It does not compute binding affinities, docking scores or other measures of binding strength.
Home page is at <https://github.com/google-deepmind/alphafold3).
You must request the model parameters from Google DeepMind
The AlphaFold 3 model parameters are
not redistributed by Mahuika. To obtain them you must agree to the
AlphaFold 3 Model Parameters Terms of Use
and request access from Google DeepMind
yourself. The terms permit non-commercial use only and prohibit
sharing the weights. Once you receive them, store them in a directory
you control (for example under your project space) and point
--model_dir at it.
AlphaFold 3 module and databases¶
The application and its databases are available as modules:
module spider AlphaFold
Versions:
AlphaFold/3.0.0
AlphaFold/3.0.1
AlphaFold/3.0.2
module spider AlphaFold3DB
Versions:
AlphaFold3DB/2024-12
Loading the AlphaFold3DB module sets an environment variable
($AF3DB) that points at the selected database version, so you can pass
it (and the individual files within it) to the --db_dir and
--*_database_path options:
module load AlphaFold3DB/2024-12
echo $AF3DB
On Mahuika you also need to load HMMER, which AlphaFold 3 uses for its
genetic search. Loading it sets $HMMER_DIR, which you pass to the
--*_binary_path options:
module load HMMER/3.4-GCC-12.3.0
echo $HMMER_DIR
Input JSON¶
AlphaFold 3 reads a JSON description of the structure to fold. A single
model handles both monomers and multimers — there is no model-preset
option to set — and whether you fold a monomer or a complex is decided
entirely by what you list under sequences in the JSON. The
run_alphafold.py command is identical in either case.
Monomer — a single protein block with one chain id
(fold_input.json):
{
"name": "my_protein",
"modelSeeds": [1],
"sequences": [
{
"protein": {
"id": "A",
"sequence": "GMRESYANENQFGFKTINSDIHKIVIVGGYGKLGGLFARYLRASGYPISILDREDWAVAESILANADVVIVSVPINLTLETIERLKPYLTENMLLADLTSVKREPLAKMLEVHTGAVLGLDVLVGGGNTAEAFIHGVQTILTKPSLHALILEYSSQEMQE"
}
}
],
"dialect": "alphafold3",
"version": 1
}
Multimer — add more entries to the sequences list, each with its
own chain id. This example is a heterodimer of two different proteins
(chains A and B):
{
"name": "my_complex",
"modelSeeds": [1],
"sequences": [
{
"protein": {
"id": "A",
"sequence": "GMRESYANENQFGFKTINSDIHKIVIVGGYGKLGGLFARYLRASGYPISILDREDWAVAESILANADVVIVSVPINLTLETIERLKPYLTENMLLADLTSVKREPLAKMLEVHTGAVLGLDVLVGGGNTAEAFIHGVQTILTKPSLHALILEYSSQEMQE"
}
},
{
"protein": {
"id": "B",
"sequence": "MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH"
}
}
],
"dialect": "alphafold3",
"version": 1
}
For a homo-multimer (the same sequence repeated), give a single protein
block a list of ids instead, for example "id": ["A", "B"]. A complex can
also mix molecule types — alongside protein blocks the sequences list
accepts dna, rna, ligand and ion entries. See the
input documentation
for the full schema.
Example Slurm script¶
On Mahuika, AlphaFold 3 does not infer the database files or search-tool
binaries automatically: you pass the genetic databases via the
--*_database_path options (all found under
$AF3DB), the HMMER binaries via the --*_binary_path options (under
$HMMER_DIR), and your own copy of the model parameters via
--model_dir. The following runs both the data pipeline and inference in
a single GPU job for one input JSON:
#!/bin/bash -e
#SBATCH --account nesi12345
#SBATCH --job-name af3-example
#SBATCH --mem 24G
#SBATCH --cpus-per-task 8
#SBATCH --gpus-per-node A100:1
#SBATCH --time 02:00:00
#SBATCH --output %j.out
module purge
module load AlphaFold/3.0.2
module load AlphaFold3DB/2024-12
module load HMMER/3.4-GCC-12.3.0
INPUT=/nesi/project/nesi12345/alphafold3/fold_input.json
OUTPUT=/nesi/project/nesi12345/alphafold3/results
MODEL_DIR=/nesi/project/nesi12345/alphafold3/models
run_alphafold.py \
--json_path=${INPUT} \
--model_dir=${MODEL_DIR} \
--output_dir=${OUTPUT} \
--db_dir=${AF3DB} \
--uniref90_database_path=${AF3DB}/uniref90_2022_05.fa \
--mgnify_database_path=${AF3DB}/mgy_clusters_2022_05.fa \
--uniprot_cluster_annot_database_path=${AF3DB}/uniprot_all_2021_04.fa \
--small_bfd_database_path=${AF3DB}/bfd-first_non_consensus_sequences.fasta \
--pdb_database_path=${AF3DB}/mmcif_files \
--seqres_database_path=${AF3DB}/pdb_seqres_2022_09_28.fasta \
--hmmalign_binary_path=${HMMER_DIR}/hmmalign \
--hmmbuild_binary_path=${HMMER_DIR}/hmmbuild \
--hmmsearch_binary_path=${HMMER_DIR}/hmmsearch \
--jackhmmer_binary_path=${HMMER_DIR}/jackhmmer \
--nhmmer_binary_path=${HMMER_DIR}/nhmmer
To fold several inputs, place all of the JSON files in a directory and
replace --json_path=${INPUT} with --input_dir=/path/to/json_dir, or
call run_alphafold.py once per file (for example from a
job array).
Splitting the data pipeline and inference
The data pipeline (genetic/template search) is CPU-bound and does not
need a GPU, while inference is GPU-bound. For large batches you can run
the two stages as separate jobs — add --norun_inference to a CPU-only
job to produce an enriched JSON (containing the MSAs), then feed that
JSON into a GPU job with --norun_data_pipeline — so a GPU is not held
idle during the search.
AlphaFold 3 troubleshooting¶
-
With the default configuration AlphaFold 3 fits inputs of up to roughly 5,120 tokens on an 80 GB GPU. For larger complexes, or if you hit out-of-memory errors during inference, enable unified memory so the GPU can spill into host memory:
export XLA_PYTHON_CLIENT_PREALLOCATE=true export XLA_PYTHON_CLIENT_MEM_FRACTION=0.95 export XLA_CLIENT_MEM_FRACTION=0.95 -
The data pipeline can be memory hungry for large sequences; increase
--memif the pipeline stage is killed.
AlphaFold 3 license¶
The source code and the model parameters are governed by separate terms — only the latter carries the non-commercial restriction:
- Source code is released under the Apache License, Version 2.0.
- Model parameters and any output generated using them are subject to the AlphaFold 3 Model Parameters Terms of Use, which permit non-commercial use only and prohibit redistributing the parameters. You must obtain the parameters directly from Google DeepMind (see the warning above).
AlphaFold module ( >= 2.3.2)¶
As of version 2.3.2 of AlphaFold, we recommend deploying AlphaFold via the module.
Example Slurm script for monomer¶
Input fasta used in following example is 3RGK (https://www.rcsb.org/structure/3rgk).
#!/bin/bash -e
#SBATCH --account nesi12345
#SBATCH --job-name af-2.3.2-monomer
#SBATCH --mem 24G
#SBATCH --cpus-per-task 8
#SBATCH --gpus-per-node A100:1
#SBATCH --time 02:00:00
#SBATCH --output %j.out
module purge
module load AlphaFold2DB/2023-04
module load AlphaFold/2.3.2
INPUT=/nesi/project/nesi12345/alphafold/input_data
OUTPUT=/nesi/project/nesi12345/alphafold/results
run_alphafold.py --use_gpu_relax \
--data_dir=$AF2DB \
--uniref90_database_path=$AF2DB/uniref90/uniref90.fasta \
--mgnify_database_path=$AF2DB/mgnify/mgy_clusters_2022_05.fa \
--bfd_database_path=$AF2DB/bfd/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt \
--uniref30_database_path=$AF2DB/uniref30/UniRef30_2021_03 \
--pdb70_database_path=$AF2DB/pdb70/pdb70 \
--template_mmcif_dir=$AF2DB/pdb_mmcif/mmcif_files \
--obsolete_pdbs_path=$AF2DB/pdb_mmcif/obsolete.dat \
--model_preset=monomer \
--max_template_date=2022-6-1 \
--db_preset=full_dbs \
--output_dir=$OUTPUT \
--fasta_paths=${INPUT}/rcsb_pdb_3RGK.fasta
Example Slurm script for multimer¶
Input fasta used in following example
T1083
GAMGSEIEHIEEAIANAKTKADHERLVAHYEEEAKRLEKKSEEYQELAKVYKKITDVYPNIRSYMVLHYQNLTRRYKEAAEENRALAKLHHELAIVED
T1084
MAAHKGAEHHHKAAEHHEQAAKHHHAAAEHHEKGEHEQAAHHADTAYAHHKHAEEHAAQAAKHDAEHHAPKPH
#!/bin/bash -e
#SBATCH --account nesi12345
#SBATCH --job-name af-2.3.2-multimer
#SBATCH --mem 30G
#SBATCH --cpus-per-task 4
#SBATCH --gpus-per-node A100:1
#SBATCH --time 01:45:00
#SBATCH --output slurmout.%j.out
module purge
module load AlphaFold2DB/2023-04
module load AlphaFold/2.3.2
INPUT=/nesi/project/nesi12345/input_data
OUTPUT=/nesi/project/nesi12345/alphafold/2.3_multimer
run_alphafold.py \
--use_gpu_relax \
--data_dir=$AF2DB \
--model_preset=multimer \
--uniprot_database_path=$AF2DB/uniprot/uniprot.fasta \
--uniref90_database_path=$AF2DB/uniref90/uniref90.fasta \
--mgnify_database_path=$AF2DB/mgnify/mgy_clusters_2022_05.fa \
--bfd_database_path=$AF2DB/bfd/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt \
--uniref30_database_path=$AF2DB/uniref30/UniRef30_2021_03 \
--pdb_seqres_database_path=$AF2DB/pdb_seqres/pdb_seqres.txt \
--template_mmcif_dir=$AF2DB/pdb_mmcif/mmcif_files \
--obsolete_pdbs_path=$AF2DB/pdb_mmcif/obsolete.dat \
--max_template_date=2022-6-1 \
--db_preset=full_dbs \
--output_dir=${OUTPUT} \
--fasta_paths=${INPUT}/test_multimer.fasta
AlphaFold Singularity container (prior to v2.3.2)¶
If you would like to use a version prior to 2.3.2, It can be done via the Singularity containers.
We prepared a Singularity container image based on the official
Dockerfile with some
modifications. Image (.simg) and the corresponding definition file
(.def) are stored in /opt/nesi/containers/AlphaFold/
Example Slurm scripts for Singularity container based AF2 deployment¶
Monomer¶
#!/bin/bash -e
#SBATCH --account nesi12345
#SBATCH --job-name alphafold2_monomer_example
#SBATCH --mem 30G
#SBATCH --cpus-per-task 6
#SBATCH --gpus-per-node A100:1
#SBATCH --time 02:00:00
#SBATCH --output slurmout.%j.out
module purge
module load AlphaFold2DB/2022-06
module load cuDNN/8.1.1.33-CUDA-11.2.0 Singularity/3.9.8
INPUT=/path/to/input_data
OUTPUT=/path/to/results
export SINGULARITY_BIND="$INPUT,$OUTPUT,$AF2DB"
singularity exec --nv /opt/nesi/containers/AlphaFold/alphafold_2.2.0.simg python /app/alphafold/run_alphafold.py \
--use_gpu_relax \
--data_dir=$AF2DB \
--uniref90_database_path=$AF2DB/uniref90/uniref90.fasta \
--mgnify_database_path=$AF2DB/mgnify/mgy_clusters_2018_12.fa \
--bfd_database_path=$AF2DB/bfd/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt \
--uniclust30_database_path=$AF2DB/uniclust30/uniclust30_2018_08/uniclust30_2018_08 \
--pdb70_database_path=$AF2DB/pdb70/pdb70 \
--template_mmcif_dir=$AF2DB/pdb_mmcif/mmcif_files \
--obsolete_pdbs_path=$AF2DB/pdb_mmcif/obsolete.dat \
--model_preset=monomer \
--max_template_date=2022-1-1 \
--db_preset=full_dbs \
--output_dir=$OUTPUT \
--fasta_paths=$INPUT/rcsb_pdb_3RGK.fasta
Multimer¶
#!/bin/bash -e
#SBATCH --account nesi12345
#SBATCH --job-name alphafold2_monomer_example
#SBATCH --mem 30G
#SBATCH --cpus-per-task 6
#SBATCH --gpus-per-node A100:1
#SBATCH --time 02:00:00
#SBATCH --output slurmout.%j.out
module purge
module load AlphaFold2DB/2022-06
module load cuDNN/8.1.1.33-CUDA-11.2.0 Singularity/3.9.8
INPUT=/path/to/input_data
OUTPUT=/path/to/results
export SINGULARITY_BIND="$INPUT,$OUTPUT,$AF2DB"
singularity exec --nv /opt/nesi/containers/AlphaFold/alphafold_2.2.0.simg python /app/alphafold/run_alphafold.py \
--use_gpu_relax \
--data_dir=$AF2DB \
--uniref90_database_path=$AF2DB/uniref90/uniref90.fasta \
--mgnify_database_path=$AF2DB/mgnify/mgy_clusters_2018_12.fa \
--bfd_database_path=$AF2DB/bfd/bfd_metaclust_clu_complete_id30_c90_final_seq.sorted_opt \
--uniclust30_database_path=$AF2DB/uniclust30/uniclust30_2018_08/uniclust30_2018_08 \
--pdb_seqres_database_path=$AF2DB/pdb_seqres/pdb_seqres.txt \
--template_mmcif_dir=$AF2DB/pdb_mmcif/mmcif_files \
--obsolete_pdbs_path=$AF2DB/pdb_mmcif/obsolete.dat \
--uniprot_database_path=$AF2DB/uniprot/uniprot.fasta \
--model_preset=multimer \
--max_template_date=2022-1-1 \
--db_preset=full_dbs \
--output_dir=$OUTPUT \
--fasta_paths=$INPUT/rcsb_pdb_3RGK.fasta
Explanation of Slurm variables and Singularity flags¶
- Values for
--mem,--cpus-per-taskand--timeSlurm variables are for 3RGK.fasta. Adjust them accordingly - The
--nvflag enables GPU support. --pwd /app/alphafoldis to workaround this existing issue
AlphaFold2 : Initial Release ( this version does not support multimer)¶
Input fasta used in following example and subsequent benchmarking is 3RGK (https://www.rcsb.org/structure/3rgk).
Troubleshooting¶
- If you are to encounter the message "RuntimeError: Resource exhausted: Out of memory" , add the following variables to the slurm script
For module based runs
export TF_FORCE_UNIFIED_MEMORY=1
export XLA_PYTHON_CLIENT_MEM_FRACTION=4.0
For Singularity based runs
export SINGULARITYENV_TF_FORCE_UNIFIED_MEMORY=1
export SINGULARITYENV_XLA_PYTHON_CLIENT_MEM_FRACTION=4.0
License and Disclaimer¶
This is not an officially supported Google product.
Copyright 2021 DeepMind Technologies Limited.
AlphaFold Code License¶
Licensed under the Apache License, Version 2.0 (the "License"); you may not use this file except in compliance with the License. You may obtain a copy of the License at https://www.apache.org/licenses/LICENSE-2.0.
Unless required by applicable law or agreed to in writing, software distributed under the License is distributed on an "AS IS" BASIS, WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. See the License for the specific language governing permissions and limitations under the License.
Model Parameters License¶
The AlphaFold parameters are made available for non-commercial use only, under the terms of the Creative Commons Attribution-NonCommercial 4.0 International (CC BY-NC 4.0) license. You can find details at: https://creativecommons.org/licenses/by-nc/4.0/legalcode